CacheBy
Atlas Antibodies Anti-MRPL24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL24 Antibody

상품 한눈에 보기

Human MRPL24 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. 재조합 발현 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, PBS/glycerol buffer에 보존제를 포함합니다.

카탈로그번호
HPA030295-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030295-100 Anti-MRPL24 Antibody, mitochondrial ribosomal protein L24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030295-25 Anti-MRPL24 Antibody, mitochondrial ribosomal protein L24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL24 Antibody

Anti-MRPL24 Antibody

mitochondrial ribosomal protein L24

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human MRPL24

Alternative Gene Names

  • MRP-L18

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein mitochondrial ribosomal protein L24
Target Gene MRPL24
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence GKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAG

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000022234 87%
Mouse ENSMUSG00000019710 85%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Tooltip Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.