CacheBy
Atlas Antibodies Anti-MRC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRC2 Antibody

상품 한눈에 보기

휴먼 MRC2 단백질을 인식하는 폴리클로날 항체로, IHC 분석에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 정제되었습니다. CD280, ENDO180 등 대체 유전자명으로도 알려져 있습니다. Human 특이 반응성을 검증하였습니다.

카탈로그번호
HPA041991-xxx (2개 옵션)
카테고리
Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041991-100 Anti-MRC2 Antibody, mannose receptor, C type 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041991-25 Anti-MRC2 Antibody, mannose receptor, C type 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRC2 Antibody

Anti-MRC2 Antibody

mannose receptor, C type 2

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human MRC2

Alternative Gene Names

CD280, CLEC13E, ENDO180, KIAA0709

Open Datasheet

Target Information

항목 내용
Target Protein mannose receptor, C type 2
Target Gene MRC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQ

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000006548 90%
Mouse ENSMUSG00000020695 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.