CacheBy
Atlas Antibodies Anti-MPZL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MPZL2 Antibody

상품 한눈에 보기

인간 MPZL2 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit 유래 IgG로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, Human에서 검증된 반응성을 보입니다. 최적 조건은 사용자 실험에 따라 조정 가능합니다.

카탈로그번호
HPA060740-xxx (2개 옵션)
카테고리
Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060740-100 Anti-MPZL2 Antibody, myelin protein zero-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060740-25 Anti-MPZL2 Antibody, myelin protein zero-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MPZL2 Antibody

Anti-MPZL2 Antibody

Target: Myelin protein zero-like 2 (MPZL2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MPZL2.


Alternative Gene Names

  • EVA
  • EVA1

Open Datasheet


Target Information

항목 내용
Target Protein Myelin protein zero-like 2
Target Gene MPZL2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat (77%), Mouse (71%)

Antigen Sequence:
VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.