CacheBy
Atlas Antibodies Anti-MPV17L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MPV17L Antibody

상품 한눈에 보기

인간 MPV17L 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 반응성이 검증되었으며, 글리세롤/PBS 완충액에 보존됩니다.

카탈로그번호
HPA041180-xxx (2개 옵션)
카테고리
Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041180-100 Anti-MPV17L Antibody, MPV17 mitochondrial membrane protein-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041180-25 Anti-MPV17L Antibody, MPV17 mitochondrial membrane protein-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MPV17L Antibody

Anti-MPV17L Antibody

Target: MPV17 mitochondrial membrane protein-like
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MPV17L


Alternative Gene Names

FLJ39599, MLPH1, MLPH2, MPV17L1


Target Information

항목 내용
Target Protein MPV17 mitochondrial membrane protein-like
Target Gene MPV17L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000022679 (50%), Rat ENSRNOG00000003285 (40%)

Epitope Sequence:
SQQSGDGTFKSAFTILYTKGTSATEGYPKK


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


Datasheet

Open Datasheet (PDF)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.