AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MPP6 Antibody
상품 한눈에 보기
Human MPP6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, RNA-seq 데이터 기반 Orthogonal 검증을 완료했습니다. 다양한 조직에서 MPP6 단백질 발현 연구에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020456-100 Anti-MPP6 Antibody, membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020456-25 Anti-MPP6 Antibody, membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MPP6 Antibody
Anti-MPP6 Antibody
Target: membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6)
Type: Polyclonal Antibody against Human MPP6
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal antibody targeting human MPP6 protein, validated for use in immunohistochemistry and western blot applications.
Alternative Gene Names
p55T, PALS2, VAM-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6) |
| Target Gene | MPP6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARIL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000021579 (95%), Mouse ENSMUSG00000038388 (94%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.