CacheBy
Atlas Antibodies Anti-MPO Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MPO Antibody

상품 한눈에 보기

인체 MPO 단백질을 타깃으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 발현 검증 제공. Rabbit 유래 IgG 형식이며, PrEST 항원 기반 친화 정제. 인체 반응성 검증 완료.

카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061464-100 Anti-MPO Antibody, myeloperoxidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061464-25 Anti-MPO Antibody, myeloperoxidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MPO Antibody

Anti-MPO Antibody

Target Information

  • Target Protein: Myeloperoxidase
  • Target Gene: MPO
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    SRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNC

Product Description

Polyclonal antibody against human myeloperoxidase (MPO).

Open Datasheet

  • Orthogonal validation of protein expression using IHC
    Comparison to RNA-seq data of corresponding target in high and low expression tissues.

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000009350 89%
Rat ENSRNOG00000008310 89%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.