Atlas Antibodies Anti-MPO Antibody

상품 한눈에 보기

Human MPO 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. Recombinant PrEST 항원으로 제작되어 높은 특이성과 재현성을 제공. 인체 조직 내 MPO 발현 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021147-100 Anti-MPO Antibody, myeloperoxidase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021147-25 Anti-MPO Antibody, myeloperoxidase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Myeloperoxidase (MPO)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human MPO.

항목	내용
Target Protein	Myeloperoxidase
Target Gene	MPO
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	SRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNC

항목	내용
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000008310 (89%), Mouse ENSMUSG00000009350 (89%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand