CacheBy
Atlas Antibodies Anti-MPIG6B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MPIG6B Antibody

상품 한눈에 보기

인간 MPIG6B 단백질을 표적으로 하는 폴리클로날 항체. 혈소판 및 거핵세포 억제 수용체 연구에 적합. 토끼 유래 IgG 항체로 PrEST 항원 친화 정제됨. 인간 반응성 검증 완료.

카탈로그번호
HPA054404-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054404-100 Anti-MPIG6B Antibody, megakaryocyte and platelet inhibitory receptor G6b 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054404-25 Anti-MPIG6B Antibody, megakaryocyte and platelet inhibitory receptor G6b 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MPIG6B Antibody

Anti-MPIG6B Antibody

Target Information

  • Target Protein: Megakaryocyte and platelet inhibitory receptor G6b
  • Target Gene: MPIG6B
  • Alternative Gene Names: C6orf25, G6b, G6b-B, NG31

Product Description

Polyclonal antibody against human MPIG6B.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

APLVKTEPQRPVKEEEPKIPGDLDQEPSLLYADLDHLALSRPRRLSTADPADA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000073414): 62%
  • Rat (ENSRNOG00000026936): 58%

ICC (Immunocytochemistry)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand
Verified Species Reactivity Human
Applications ICC

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.