AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MOS Antibody
상품 한눈에 보기
인간 MOS 단백질에 대한 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공. 다양한 종 간 교차 반응성 정보 포함.
- 카탈로그번호
- HPA040424-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040424-100 Anti-MOS Antibody, v-mos Moloney murine sarcoma viral oncogene homolog 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040424-25 Anti-MOS Antibody, v-mos Moloney murine sarcoma viral oncogene homolog 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MOS Antibody
Anti-MOS Antibody
v-mos Moloney murine sarcoma viral oncogene homolog
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (Recombinant Expression)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human MOS
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | v-mos Moloney murine sarcoma viral oncogene homolog |
| Target Gene | MOS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | CKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVF |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000008567 (73%), Mouse ENSMUSG00000078365 (72%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.