CacheBy
Atlas Antibodies Anti-MMS19 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MMS19 Antibody

상품 한눈에 보기

인간 MMS19 단백질을 표적으로 하는 폴리클로날 항체로, 세포 내 철-황 복합체 조립 연구에 적합합니다. Rabbit 유래 IgG 형식이며, 높은 종간 서열 일치도를 보입니다. Affinity purification으로 높은 특이성과 순도를 확보했습니다.

카탈로그번호
HPA051936-xxx (2개 옵션)
카테고리
Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051936-100 Anti-MMS19 Antibody, MMS19 homolog, cytosolic iron-sulfur assembly component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051936-25 Anti-MMS19 Antibody, MMS19 homolog, cytosolic iron-sulfur assembly component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MMS19 Antibody

Anti-MMS19 Antibody

Target: MMS19 homolog, cytosolic iron-sulfur assembly component
Supplier: Atlas Antibodies


면역세포화학(ICC) 등 다양한 생명과학 연구에 적합

OCR 텍스트 (이미지 내용):
Recommended for Immunocytochemistry (ICC)


Product Description

Polyclonal Antibody against Human MMS19


Alternative Gene Names

  • hMMS19
  • MET18
  • MMS19L

Open Datasheet


Target Information

항목 내용
Target Protein MMS19 homolog, cytosolic iron-sulfur assembly component
Target Gene MMS19
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000025159 (90%), Rat ENSRNOG00000046769 (88%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LVFMALTDPSTQLQLVGIRTLTVLGAQPDLLSYEDLELAVGHLYRLSFLKEDSQSCRVAALEASGTLAALYPVAFSSHLVPKLA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.