
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MMAB Antibody
상품 한눈에 보기
Human MMAB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation으로 검증되었으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human에 반응하며, cblB 및 CFAP23 유전자와 관련됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039017-100 Anti-MMAB Antibody, methylmalonic aciduria (cobalamin deficiency) cblB type 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039017-25 Anti-MMAB Antibody, methylmalonic aciduria (cobalamin deficiency) cblB type 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MMAB Antibody
Anti-MMAB Antibody
Target Information
- Target Protein: methylmalonic aciduria (cobalamin deficiency) cblB type
- Target Gene: MMAB
- Alternative Gene Names: cblB, CFAP23
Product Description
Polyclonal antibody against Human MMAB.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
Species Reactivity
- Verified Species: Human
- Interspecies Information:
- Mouse ENSMUSG00000029575 (84%)
- Rat ENSRNOG00000049426 (84%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



