Atlas Antibodies Anti-MMAB Antibody

상품 한눈에 보기

Human MMAB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation으로 검증되었으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human에 반응하며, cblB 및 CFAP23 유전자와 관련됩니다.

카탈로그번호: HPA039017-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039017-100 Anti-MMAB Antibody, methylmalonic aciduria (cobalamin deficiency) cblB type 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039017-25 Anti-MMAB Antibody, methylmalonic aciduria (cobalamin deficiency) cblB type 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MMAB Antibody

Anti-MMAB Antibody

Target Information

Target Protein: methylmalonic aciduria (cobalamin deficiency) cblB type
Target Gene: MMAB
Alternative Gene Names: cblB, CFAP23

Product Description

Polyclonal antibody against Human MMAB.

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Immunocytochemistry (ICC)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL

Species Reactivity

Verified Species: Human
Interspecies Information:
- Mouse ENSMUSG00000029575 (84%)
- Rat ENSRNOG00000049426 (84%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.