CacheBy
Atlas Antibodies Anti-MLLT11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MLLT11 Antibody

상품 한눈에 보기

Rabbit polyclonal antibody against human MLLT11 단백질로, IHC 및 ICC 적용에 적합. 높은 특이성과 재현성을 가지며, PrEST 항원을 이용해 친화 정제됨. Human에 검증되었으며 Mouse 및 Rat과 높은 서열 유사성을 보임.

카탈로그번호
HPA000540-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000540-100 Anti-MLLT11 Antibody, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000540-25 Anti-MLLT11 Antibody, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MLLT11 Antibody

Anti-MLLT11 Antibody

Target: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MLLT11.


Alternative Gene Names

  • AF1Q

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11
Target Gene MLLT11
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFEL

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 유사도
Mouse ENSMUSG00000053192 83%
Rat ENSRNOG00000021110 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application Icon
ICC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.