CacheBy
Atlas Antibodies Anti-MKI67IP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MKI67IP Antibody

상품 한눈에 보기

인간 NIFK 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. siRNA knockdown을 통한 유전적 검증 완료. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035735-100 Anti-MKI67IP Antibody, nucleolar protein interacting with the FHA domain of MKI67 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035735-25 Anti-MKI67IP Antibody, nucleolar protein interacting with the FHA domain of MKI67 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MKI67IP Antibody

Anti-MKI67IP Antibody

nucleolar protein interacting with the FHA domain of MKI67

  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Genetic validation in WB by siRNA knockdown
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human NIFK

Alternative Gene Names

NIFK, hNIFK, Nopp34

Open Datasheet

Target Information

항목 내용
Target Protein nucleolar protein interacting with the FHA domain of MKI67
Target Gene NIFK
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000026377 (48%), Rat ENSRNOG00000025701 (43%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.