
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MKI67IP Antibody
상품 한눈에 보기
인간 NIFK 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. siRNA knockdown을 통한 유전적 검증 완료. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035735-100 Anti-MKI67IP Antibody, nucleolar protein interacting with the FHA domain of MKI67 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035735-25 Anti-MKI67IP Antibody, nucleolar protein interacting with the FHA domain of MKI67 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MKI67IP Antibody
Anti-MKI67IP Antibody
nucleolar protein interacting with the FHA domain of MKI67
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Genetic validation in WB by siRNA knockdown
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human NIFK
Alternative Gene Names
NIFK, hNIFK, Nopp34
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nucleolar protein interacting with the FHA domain of MKI67 |
| Target Gene | NIFK |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000026377 (48%), Rat ENSRNOG00000025701 (43%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



