Atlas Antibodies Anti-MIS18A Antibody

상품 한눈에 보기

인간 MIS18A 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 및 WB에서 정교한 단백질 발현 검증에 사용됩니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA018286-100 Anti-MIS18A Antibody, MIS18 kinetochore protein A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA018286-25 Anti-MIS18A Antibody, MIS18 kinetochore protein A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: MIS18 kinetochore protein A
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal antibody against Human MIS18A.

B28, C21orf45, C21orf46, FASP1, hMis18alpha

항목	내용
Target Protein	MIS18 kinetochore protein A
Target Gene	MIS18A
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000022978 (84%), Rat ENSRNOG00000021555 (77%)

Antigen Sequence:
KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Sheet	Material Safety Data Sheet