
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MIPOL1 Antibody
상품 한눈에 보기
Human MIPOL1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공. RNA-seq 데이터 비교를 통한 직교 검증으로 신뢰성 확보.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA002893-100 Anti-MIPOL1 Antibody, mirror-image polydactyly 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002893-25 Anti-MIPOL1 Antibody, mirror-image polydactyly 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MIPOL1 Antibody
Anti-MIPOL1 Antibody
Target: mirror-image polydactyly 1 (MIPOL1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal antibody against human MIPOL1.
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mirror-image polydactyly 1 |
| Target Gene | MIPOL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Amino Acid Sequence | KTAALVEEVYFAQKERDEAVMSRLQLAIEERDEAIARAKHMEMSLKVLENINPEENDMTLQELLNRINNADTGIAIQKNGAIIVDRIYKTKECKMRITAEEMSALIEERDAALSKCKRLEQELHHVKEQNQTSANNMRHLTAENNQ |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000009151 (88%), Mouse ENSMUSG00000047022 (85%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



