AI 생성

1 / 2

Atlas Antibodies Anti-MIER1 Antibody

상품 한눈에 보기

Human MIER1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. Rabbit에서 생산되었으며, PrEST 항원으로 친화 정제된 고품질 항체입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019589-100 Anti-MIER1 Antibody, mesoderm induction early response 1, transcriptional regulator 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019589-25 Anti-MIER1 Antibody, mesoderm induction early response 1, transcriptional regulator 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mesoderm induction early response 1, transcriptional regulator
Supplier: Atlas Antibodies

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human MIER1

항목	내용
Target Protein	mesoderm induction early response 1, transcriptional regulator
Target Gene	MIER1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (97%), Rat (96%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEI

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.