CacheBy
Atlas Antibodies Anti-MICB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MICB Antibody

상품 한눈에 보기

Human MICB 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며 PBS/glycerol buffer에 보존됨.

카탈로그번호
HPA064618-xxx (2개 옵션)
카테고리
Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064618-100 Anti-MICB Antibody, MHC class I polypeptide-related sequence B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064618-25 Anti-MICB Antibody, MHC class I polypeptide-related sequence B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MICB Antibody

Anti-MICB Antibody

Target Information

  • Target Protein: MHC class I polypeptide-related sequence B
  • Target Gene: MICB
  • Alternative Gene Names: PERB11.2

이미지 내 텍스트(OCR): ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human MICB.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000019550 (33%)
  • Mouse ENSMUSG00000023030 (33%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.