CacheBy
Atlas Antibodies Anti-MICAL3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MICAL3 Antibody

상품 한눈에 보기

Human MICAL3 단백질을 인식하는 Rabbit Polyclonal 항체로, microtubule 관련 단백질 연구에 적합. Affinity purification으로 높은 특이성과 재현성 보장. 인체 시료에서 검증됨. PBS/glycerol buffer에 보존제로 sodium azide 포함.

카탈로그번호
HPA000639-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000639-100 Anti-MICAL3 Antibody, microtubule associated monooxygenase, calponin and LIM domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000639-25 Anti-MICAL3 Antibody, microtubule associated monooxygenase, calponin and LIM domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MICAL3 Antibody

Anti-MICAL3 Antibody

Target: microtubule associated monooxygenase, calponin and LIM domain containing 3 (MICAL3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human MICAL3.


Alternative Gene Names

  • KIAA0819

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein microtubule associated monooxygenase, calponin and LIM domain containing 3
Target Gene MICAL3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PVQSQSDTKDRLGSPLAVDEALRRSDLVEEFWMKSAEIRRSLGLTPVDRSKGPEPSFPTPAFRPVSLKSYSVEKSPQDEGLHLLKPLSIPKRLGLPKPEGEPLSLPTPRSPSDRELRSAQEERRELSSSSGLGLHGSSSNMKTL

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Identity
Rat ENSRNOG00000053203 80%
Mouse ENSMUSG00000051586 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.