CacheBy
Atlas Antibodies Anti-MICAL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MICAL1 Antibody

상품 한눈에 보기

Human MICAL1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purified 방식으로 제조됨. IHC 등 다양한 응용에 적합하며, 고순도와 높은 특이성을 제공. Glycerol 기반 buffer로 장기 보관 가능.

카테고리
Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030175-100 Anti-MICAL1 Antibody, microtubule associated monooxygenase, calponin and LIM domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030175-25 Anti-MICAL1 Antibody, microtubule associated monooxygenase, calponin and LIM domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MICAL1 Antibody

Anti-MICAL1 Antibody

Target: microtubule associated monooxygenase, calponin and LIM domain containing 1 (MICAL1)

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human MICAL1

Alternative Gene Names

DKFZp434B1517, FLJ11937, FLJ21739, MICAL, NICAL

Open Datasheet

Target Information

항목 내용
Target Protein microtubule associated monooxygenase, calponin and LIM domain containing 1
Target Gene MICAL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VLFLSKLQRTLQRSRAKENAEDAGGKKLRLEMEAETPSTEVPPDPEPGVPLTPPSQHQEAGAGDLCALCGEHLYVLER

Verified Species Reactivity

Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000019823 55%
Rat ENSRNOG00000000307 53%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 실험 목적에 따라 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.