
원본
Atlas Antibodies Anti-MGEA5 Antibody
상품 한눈에 보기
Human MGEA5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. MEA5, NCOAT, OGA 유전자 대체명으로도 알려져 있으며, 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human, Mouse, Rat 반응성 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA076501-100 Anti-MGEA5 Antibody, meningioma expressed antigen 5 (hyaluronidase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076501-25 Anti-MGEA5 Antibody, meningioma expressed antigen 5 (hyaluronidase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MGEA5 Antibody
Anti-MGEA5 Antibody
Target: meningioma expressed antigen 5 (hyaluronidase)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human MGEA5.
Alternative Gene Names
MEA5, NCOAT, OGA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | meningioma expressed antigen 5 (hyaluronidase) |
| Target Gene | MGEA5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | WTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVM |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000017822 (100%), Mouse ENSMUSG00000025220 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



