CacheBy
Atlas Antibodies Anti-MGAT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MGAT2 Antibody

상품 한눈에 보기

인간 MGAT2 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit 유래 IgG이며 IHC 및 WB에 적합합니다. PrEST 항원으로 특이적 정제되었습니다. 인간 반응성이 검증되었으며 쥐 및 마우스와 높은 서열 유사성을 가집니다.

카탈로그번호
HPA043721-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043721-100 Anti-MGAT2 Antibody, mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043721-25 Anti-MGAT2 Antibody, mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MGAT2 Antibody

Anti-MGAT2 Antibody

Target Information

  • Target Protein: mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
  • Target Gene: MGAT2
  • Alternative Gene Name: GNT-II

Product Description

Polyclonal antibody against human MGAT2.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    PSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSH

Verified Species Reactivity

  • Human

Interspecies Sequence Identity

Species Gene ID Sequence Identity
Rat ENSRNOG00000004234 84%
Mouse ENSMUSG00000043998 83%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Usage Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.