CacheBy
Atlas Antibodies Anti-MFSD13A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MFSD13A Antibody

상품 한눈에 보기

Human MFSD13A를 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC에 적합합니다. Affinity purification 방식으로 고순도 확보. PBS/glycerol buffer에 보존되어 안정적이며 다양한 연구 응용에 활용 가능합니다.

카탈로그번호
HPA018031-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018031-100 Anti-MFSD13A Antibody, major facilitator superfamily domain containing 13A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018031-25 Anti-MFSD13A Antibody, major facilitator superfamily domain containing 13A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MFSD13A Antibody

Anti-MFSD13A Antibody

Target: major facilitator superfamily domain containing 13A (MFSD13A)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human MFSD13A


Alternative Gene Names

bA18I14.8, C10orf77, FLJ22529, TMEM180

Open Datasheet


Target Information

항목 내용
Target Protein major facilitator superfamily domain containing 13A
Target Gene MFSD13A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019674 (72%), Mouse ENSMUSG00000025227 (65%)

Antigen Sequence:
QLLRRRVEAARKDPGCSGLVVDSGLCGEELLVGSEEADSITLGRYLRQLARHRN


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.