Atlas Antibodies Anti-MFSD11 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA022001-100 | - | Atlas Antibodies HPA022001-100 Anti-MFSD11 Antibody, major facilitator superfamily domain containing 11 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA022001-25 | - | Atlas Antibodies HPA022001-25 Anti-MFSD11 Antibody, major facilitator superfamily domain containing 11 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-MFSD11 Antibody
major facilitator superfamily domain containing 11
Recommended Applications
Product Description
Polyclonal Antibody against Human MFSD11
Alternative Gene Names
FLJ20226, FLJ22196
Target Protein
major facilitator superfamily domain containing 11
Target Gene
MFSD11
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
DSENVLGEDESSDDQDMEVNESAQNNLTKAVDAFKKSFKLCVTKEML
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000000247 (83%)
Mouse ENSMUSG00000020818 (81%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|