CacheBy
Atlas Antibodies Anti-MFGE8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MFGE8 Antibody

상품 한눈에 보기

Human MFGE8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합합니다. RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA002807-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002807-100 Anti-MFGE8 Antibody, milk fat globule-EGF factor 8 protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002807-25 Anti-MFGE8 Antibody, milk fat globule-EGF factor 8 protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MFGE8 Antibody

Anti-MFGE8 Antibody

milk fat globule-EGF factor 8 protein


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human MFGE8


Alternative Gene Names

BA46, EDIL1, hP47, HsT19888, MFG-E8, OAcGD3S, SED1, SPAG10

Open Datasheet


Target Information

항목 내용
Target Protein milk fat globule-EGF factor 8 protein
Target Gene MFGE8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLEL

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000017510 (66%)
  • Mouse ENSMUSG00000030605 (65%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.