AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-METTL17 Antibody
상품 한눈에 보기
Human METTL17 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 보존성을 보여 마우스 및 랫에서도 활용 가능. 40% 글리세롤 기반 PBS 버퍼에 보존됨.
- 카탈로그번호
- HPA059802-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059802-100 Anti-METTL17 Antibody, methyltransferase like 17 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059802-25 Anti-METTL17 Antibody, methyltransferase like 17 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-METTL17 Antibody
Anti-METTL17 Antibody
Target: methyltransferase like 17 (METTL17)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human METTL17.
Alternative Gene Names
FLJ20859, METT11D1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methyltransferase like 17 |
| Target Gene | METTL17 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSWNKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRHGRDLYRCARVSSWGDLLPVL |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000004561 | 89% |
| Rat | ENSRNOG00000025512 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.