
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-METTL12 Antibody
상품 한눈에 보기
휴먼 METTL12 단백질에 특이적인 폴리클로날 항체. Rabbit에서 생산된 IgG로, PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 연구용 응용에 적합. 40% 글리세롤 및 PBS 완충액에 보존.
- 카탈로그번호
- HPA038533-xxx (2개 옵션)
- 카테고리
- Antibodies
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038533-100 Anti-METTL12 Antibody, methyltransferase like 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038533-25 Anti-METTL12 Antibody, methyltransferase like 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-METTL12 Antibody
Anti-METTL12 Antibody
Target: methyltransferase like 12 (METTL12)
Type: Polyclonal Antibody against Human METTL12
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody raised in rabbit against human METTL12 protein.
Alternative Gene Names
- U99HG
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methyltransferase like 12 |
| Target Gene | METTL12 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GTWDAVARGGLPRAYQLLSECLRVLNPQGTLIQFSDEDPDVRLPCLEQGSYGWTVTVQELGPFRGITYFAY |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000029529 (26%), Mouse ENSMUSG00000022842 (25%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



