
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MEOX2 Antibody
상품 한눈에 보기
Human MEOX2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB 실험에 적합하며 RNA-seq 데이터 기반 Orthogonal validation 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053793-100 Anti-MEOX2 Antibody, mesenchyme homeobox 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053793-25 Anti-MEOX2 Antibody, mesenchyme homeobox 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MEOX2 Antibody
Anti-MEOX2 Antibody
Target Protein: mesenchyme homeobox 2
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation)
- WB (Western Blot)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human MEOX2
Alternative Gene Names: GAX, MOX2
Open Datasheet
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | mesenchyme homeobox 2 |
| Target Gene | MEOX2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (96%), Mouse (95%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Antigen Sequence:
QQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKR
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



