CacheBy
Atlas Antibodies Anti-MELTF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MELTF Antibody

상품 한눈에 보기

사람 MELTF 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. RNA-seq 데이터 기반의 정교한 Orthogonal 검증을 거쳤으며, 토끼 유래 IgG 형태로 고순도 정제되었습니다. 다양한 조직 및 세포주에서 MELTF 발현 연구에 활용 가능합니다.

카탈로그번호
HPA004880-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004880-100 Anti-MELTF Antibody, melanotransferrin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004880-25 Anti-MELTF Antibody, melanotransferrin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MELTF Antibody

Anti-MELTF Antibody

melanotransferrin


  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human MELTF


Alternative Gene Names

CD228, FLJ38863, MAP97, MFI2, MGC4856, MTf, MTF1

Open Datasheet


Target Information

항목 내용
Target Protein melanotransferrin
Target Gene MELTF
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000022780 (87%), Rat ENSRNOG00000001739 (86%)

Antigen Sequence:
RSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQC


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.