CacheBy
Atlas Antibodies Anti-C8orf48 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C8orf48 Antibody

상품 한눈에 보기

인간 C8orf48 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 형식이며 PrEST 항원을 이용해 친화 정제되었습니다. 인간에 반응성이 검증되었으며, 보존용으로 글리세롤과 아지드가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027431-100 Anti-C8orf48 Antibody, chromosome 8 open reading frame 48 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027431-25 Anti-C8orf48 Antibody, chromosome 8 open reading frame 48 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C8orf48 Antibody

Anti-C8orf48 Antibody

Target: chromosome 8 open reading frame 48
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against Human C8orf48.


Alternative Gene Names

FLJ25402

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 8 open reading frame 48
Target Gene C8orf48
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000074384 (54%), Rat ENSRNOG00000047506 (26%)

Antigen Sequence

KWINYLKLKDSNFERHQPDTKLPTEITRVSDEELNALQSYCTMKINLIHRRGDSKKKTSSRHKKLHLGLDV


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.